Notice Inviting Quotations to Supply Lab 49090574

The North Eastern Hill University has published a tender for "Notice Inviting Quotations to Supply Laboratory Chemicals in the Biochemistry Department" on the 14 Feb 2022. This tender belongs to Lab Chemicals category. The vendors interested in this tender and related Lab Chemicals tenders can obtain further details by exploring Tendersniper web portal. Tendersniper sends regular tender alerts by email specifically addressing the user requirements (i.e., keywords, location and value range). Government business is a growing area of opportunity. The businesses are encouraged to actively monitor tender opportunities and participate in them to grow their business.

🚀 Unlock Latest Indian Government Tenders — Free Updated daily with verified government procurement notices.
Tender Details
 Tender Title / Description
Tender Title Notice Inviting Quotations to Supply Laboratory Chemicals in the Biochemistry Department
Tender Description amyloid-beta peptide (1-42) human: quantity 40 mgamino acid sequence:daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviapurity: 99.9 %, tfa saltaliquot with 10 x 4 mg each vial
Comments amyloid-beta peptide (1-42) human: quantity 40 mgamino acid sequence:daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviapurity: 99.9 %, tfa saltaliquot with 10 x 4 mg each vial
 Important Dates
Published Date
Due Date 20 Feb 2022 00:00:00
 Estimate and EMD
Estimated Value 0.0
EMD 0 INR
Processing Fee 0 INR
 Document Links
 Purchasing Agency
 Tender No

TSID: 49090574

 Tender Type and Location
Tender Category
Tender Type
WhatsApp Chat