The North Eastern Hill University has published a tender for "Notice Inviting Quotations to Supply Laboratory Chemicals in the Biochemistry Department" on the 14 Feb 2022. This tender belongs to Lab Chemicals category. The vendors interested in this tender and related Lab Chemicals tenders can obtain further details by exploring Tendersniper web portal. Tendersniper sends regular tender alerts by email specifically addressing the user requirements (i.e., keywords, location and value range). Government business is a growing area of opportunity. The businesses are encouraged to actively monitor tender opportunities and participate in them to grow their business.
| Tender Title | Notice Inviting Quotations to Supply Laboratory Chemicals in the Biochemistry Department |
|---|---|
| Tender Description | amyloid-beta peptide (1-42) human: quantity 40 mgamino acid sequence:daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviapurity: 99.9 %, tfa saltaliquot with 10 x 4 mg each vial |
| Comments | amyloid-beta peptide (1-42) human: quantity 40 mgamino acid sequence:daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviapurity: 99.9 %, tfa saltaliquot with 10 x 4 mg each vial |
| Published Date | |
|---|---|
| Due Date | 20 Feb 2022 00:00:00 |
| Estimated Value | 0.0 |
|---|---|
| EMD | 0 INR |
| Processing Fee | 0 INR |